Cortexa research tool·structure·esmfold

ESMFold Predict Structure

Predict protein 3D structure from amino acid sequence using ESMFold (Meta's ESM-2 language model). Returns per-residue pLDDT confidence scores (0-1 scale, higher=better) and summary statistics. Also returns the predicted PDB coordinate text. Fast single-sequence prediction (no MSA needed). Best for sequences under 400 residues. No authentication required.

Livelast probed 2026-04-30 23:07Z· 108msCortexa

Status

The most recent probe succeeded. Safe to call from the agent today.

Last probed: 1d ago
Last success: 1d ago
Last latency: 108ms

Schema

JSON Schema the agent (or your API call) must match.

{
  "properties": {
    "sequence": {
      "description": "Protein amino acid sequence in single-letter code. Example: 'MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH'. FASTA headers and whitespace are stripped. Max ~400 residues recommended for fast results.",
      "type": "string"
    }
  },
  "required": [
    "sequence"
  ],
  "type": "object"
}

Examples (1)

Default ESMFold Predict Structure call

public-safeinput

{
  "sequence": ""
}

Expected response keys: success

Anonymous-safe example. Rate-limited; no sign-in required.

Identifiers

Catalog ID: tu_ESMFold_predict_structure
Tool name: ESMFold_predict_structure
Added: 2026-04-30 22:47Z
Tags: tooluniverse

Back to catalog