Cortexa research tool·chemistry·protparam

ProtParam Calculate

Calculate physicochemical properties of a protein from its amino acid sequence (similar to ExPASy ProtParam). Returns molecular weight, isoelectric point (pI), amino acid composition, extinction coefficients at 280 nm, instability index, aliphatic index, and GRAVY (grand average of hydropathicity). No external API needed.

Livelast probed 2026-04-30 23:07Z· 89msCortexa

Status

The most recent probe succeeded. Safe to call from the agent today.

Last probed: 1d ago
Last success: 1d ago
Last latency: 89ms

Schema

JSON Schema the agent (or your API call) must match.

{
  "properties": {
    "sequence": {
      "description": "Protein amino acid sequence in single-letter code. Example: 'MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPS' (partial TP53). Whitespace, numbers, and FASTA headers are stripped.",
      "type": "string"
    }
  },
  "required": [
    "sequence"
  ],
  "type": "object"
}

Examples (1)

Default ProtParam Calculate call

public-safeinput

{
  "sequence": ""
}

Expected response keys: success

Anonymous-safe example. Rate-limited; no sign-in required.

Identifiers

Catalog ID: tu_ProtParam_calculate
Tool name: ProtParam_calculate
Added: 2026-04-30 22:47Z
Tags: tooluniverse

Back to catalog